Recombinant Hepatitis B Surface Antigen adw subtype 2
recombinant, E. coli
| Cat. No. | Amount | Price (EUR) | Buy / Note |
|---|---|---|---|
| PR-1196 | 50 μg | 393,00 | Add to Basket/Quote Add to Notepad |
For general laboratory use.
Please centrifuge briefly before opening (volume ≤2 ml).
Shipping: shipped on gel packs
Storage Conditions: store at -20 °C
avoid freeze/thaw cycles
Shelf Life: 12 months
Molecular Weight: 23 kDa
Purity: > 90 % (SDS-PAGE)
Form: liquid (supplied in PBS and 25 mM K2CO3)
Applications:
Antigen in ELISA and Western blots, excellent antigen for detection of HBV with minimal specificity problems.
Description:
HbsAg subtype adw2 produced in E. coli, is a single, non-glycosylated, polypeptide chain containing 226 amino acids and having a molecular weight of approximately 23.0kDa. HBsAg adw2 migrates on SDS-PAGE as a 23kDa monomer band with minor amounts of dimer (46kDa) and trimer (69kDa) forms.
The HBsAg is fused to a 6 His tag on C-terminus and purified by proprietary chromatographic techniques.
Specificity: Immunoreactive with sera of HBV-infected individuals.
Amino acid sequence:
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQS
PTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPG
STTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWA
SVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFF
CLWVYI
BIOZ Product Citations:
Powered by Bioz
